PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Kalax.1014s0009.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; Saxifragales; Crassulaceae; Kalanchoe
Family EIL
Protein Properties Length: 553aa    MW: 61608.5 Da    PI: 9.0714
Description EIL family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Kalax.1014s0009.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1EIN3372.28.9e-114513882303
                          XXXXXXXXXXXXXXXXXXXXXX..XXXXX.XXXXXXXXX.XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX CS
                 EIN3   2 elkkrmwkdqmllkrlkerkkqlledkeaatgakksnks.neqarrkkmsraQDgiLkYMlkemevcnaqGfvYgiipekgkpvegasds 90 
                          el++r w+d ++lkr+ker++       +a++++ksn+s + +arrk m+raQD iLkYMlk +e+cna+GfvYgiip+kgkpv+gasd+
  Kalax.1014s0009.1.p  51 ELQRRIWRDTIKLKRVKERQRLAA---LTAAEEQKSNQStTYHARRKRMARAQDRILKYMLKLVEICNARGFVYGIIPDKGKPVSGASDN 137
                          9*****************999643...4445666666551679*********************************************** PP

                          XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX....XX----STTS-HHHHHHHHHHHSSSSSS-TTS--TTT--HHHH---S--HH CS
                 EIN3  91 LraWWkekvefdrngpaaiskyqaknlilsgesslqtersseshslselqDTtlgSLLsalmqhcdppqrrfplekgvepPWWPtGkelw 180
                          Lr+WWke v+f+   ++a+ ky+a++l++++++ +   + ++   l++lqD+tlgSLLs+l+qhcdppqr++plekg++pPWWPtG+e+w
  Kalax.1014s0009.1.p 138 LRGWWKETVKFNESSTVALDKYEADCLAMAKQNAN--LNGNSYGVLQDLQDATLGSLLSSLIQHCDPPQRKYPLEKGIPPPWWPTGEEDW 225
                          ****************************9987777..5899999********************************************** PP

                          HHHHT--TT--.-----GGG--HHHHHHHHHHHHHHTGGGHHHHHHTTTTSSSSTTT--SHHHHHHHHHHTTTTT-S--XXXX..XX... CS
                 EIN3 181 wgelglskdqgtppykkphdlkkawkvsvLtavikhmsptieeirelerqskylqdkmsakesfallsvlnqeekecatvsah..ss... 265
                          w +lgl+++q+ ppy+kphdlkk+wkv++Ltavikhmsp+i++i++l +qsk+lqdkm+ake++++++vln++e+++    ++  s+   
  Kalax.1014s0009.1.p 226 WVKLGLPASQS-PPYRKPHDLKKMWKVGLLTAVIKHMSPDITKIKRLILQSKCLQDKMTAKETAIWVAVLNHQESLISLNVTSdlSEvsa 314
                          **********9.9*************************************************************9986444444533533 PP

                          XXXXXXXXXXXXXXXXXXXX.XXXXXX.XXXXXXXXXX...................................X CS
                 EIN3 266 slrkqspkvtlsceqkedve.gkkeskikhvqavktta...................................g 303
                          + ++++++  + ++++  v+  +++s  ++   +++ta                                    
  Kalax.1014s0009.1.p 315 NGQSGNKQAAIVNNHDFSVTdIEDASGLSKKGRENQTAdsvmdsqlpgdggctpirvgkqvknntggrrqpleR 388
                          22334444444444443333566666666666656555667777778888777777777665555544444442 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF048731.3E-11351297No hitNo description
Gene3DG3DSA:1.10.3180.108.4E-67176302IPR023278Ethylene insensitive 3-like protein, DNA-binding domain
SuperFamilySSF1167682.35E-58180300IPR023278Ethylene insensitive 3-like protein, DNA-binding domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 553 aa     Download sequence    Send to blast
MGTAIVVAET EEMIHDICSD IEADEVRLDN LAGSDDLGEK DVSDEEIDSK ELQRRIWRDT  60
IKLKRVKERQ RLAALTAAEE QKSNQSTTYH ARRKRMARAQ DRILKYMLKL VEICNARGFV  120
YGIIPDKGKP VSGASDNLRG WWKETVKFNE SSTVALDKYE ADCLAMAKQN ANLNGNSYGV  180
LQDLQDATLG SLLSSLIQHC DPPQRKYPLE KGIPPPWWPT GEEDWWVKLG LPASQSPPYR  240
KPHDLKKMWK VGLLTAVIKH MSPDITKIKR LILQSKCLQD KMTAKETAIW VAVLNHQESL  300
ISLNVTSDLS EVSANGQSGN KQAAIVNNHD FSVTDIEDAS GLSKKGRENQ TADSVMDSQL  360
PGDGGCTPIR VGKQVKNNTG GRRQPLERNP VAKERAQQSS DNFNEEDIRS TQLNQLMDSV  420
GDGPFIKDGV RNSMRHKKSG AETSRKRQRV LHDPVARGPG LQSKNSRKRQ RVLHEPVARG  480
PGLQSKNNQL DEDLSSVSMD KNHAEASSFE IQAHDTSHPN KQVVKLKPQE NDLGTQSYHA  540
LPSTKLSPTK NM*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1wij_A2e-7218030111132ETHYLENE-INSENSITIVE3-like 3 protein
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011037881.11e-156PREDICTED: ETHYLENE INSENSITIVE 3-like 3 protein
SwissprotO231161e-142EIL3_ARATH; ETHYLENE INSENSITIVE 3-like 3 protein
TrEMBLB9GMA11e-156B9GMA1_POPTR; ETHYLENE-INSENSITIVE3-like 3 family protein
STRINGPOPTR_0001s05360.11e-155(Populus trichocarpa)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G73730.11e-143ETHYLENE-INSENSITIVE3-like 3